DPCstruct | MC39707
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 9.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 31.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5Z841 | 1-90 | MRLSENRINFIAQQVAKELLDHQLIKFSGSRVILEAEIAKVILEDLRIEDEIDREVTEMISKMKRKIPPGSAEWDAIYQQKKEEIAR… |
| A0A7C5H3D3 | 1-110 | ERQLFFMIKKKMAAEYGVIMNYDDRYNDLAHTILDELYENYLIEYEVNENQIKNVIFKAFKAFSDAYDEIDDIVYDKIKHMQREVVP… |
| A0A7X4Y3D0 | 30-138 | None |
| Q7MQS4 | 125-234 | None |
| A0A1Y0HQ11 | 75-183 | None |
| A0A3P0X964 | 1-90 | None |
| A0A353QLJ6 | 30-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.