DPCstruct | MC39700
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 192 ± 37 aa |
| Standard deviation of domain lengths | 37.17 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 91.45 |
| Assigned Pfam label(s) | PF03073- PF12871- CL0110- CL0039- PF03371 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8W6R1 | 14-199 | MNIHNILYLNIMSSPYFKSLYEKKTYHEVIDEIYYNVKSLEPFFKGTNATSAFCLLYKLFTLKLTEKQLEGLLEHPDSPHIRAIGFL… |
| A0A2I1GPS7 | 9-182 | TWGSETTMNLNNILYQNIQASPYFKHLYELKTYHEVIDEIFNHVESLEPFLKGTTASTAFCLLYKLWTLRLTVKQVNGLIQHTDSPH… |
| F4PGM1 | 1-165 | None |
| A0A0N5CN93 | 3-193 | None |
| A0A433DKV9 | 11-149 | None |
| R1CRP3 | 45-248 | None |
| R1EHA8 | 22-174 | None |
| A0A1D6GP11 | 1-156 | None |
| A0A7S1W504 | 5-165 | None |
| Q2H4I5 | 23-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.