DPCstruct | MC3970
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6R380 | 5-70 | GARTVTRIRTLYLRTGPQTIQRDLTRAVELLKTLPTETARERAAVYMDGLSQLRSEWTLARKRRAK |
| A0A381VSW2 | 1-70 | MPTSAQIRARIKQIYHSATRTTVEEDLRQAITLLKKLEGESERARVAVYMDGLSQMRSEWILARRQATRK |
| A0A7Y5U263 | 1-65 | None |
| A0A2V8AY07 | 5-71 | None |
| A0A1F2TB40 | 4-65 | None |
| A0A7Z9TAG8 | 5-68 | None |
| A0A3D4FZE9 | 20-93 | None |
| A0A1F2S1N0 | 22-85 | None |
| A0A521T3S3 | 1-57 | None |
| A0A2V8E048 | 38-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.