DPCstruct | MC397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7RMW8 | 18-101 | DGRAPSLRSRQEKPDGAWSADQVADFLYKKMGEDKFYAICPHNDVDWETDRKRMMWTMGDVVYERKPQSRWLDEFKEESTETMS |
| A0A7S3Y740 | 117-186 | AAGAWMPDQLVAFFMDELRKGTFYIICPDNEVDIETDNLRMQWAMQDITERRPPLSRWHDDYKEDFTAYL |
| A0A505HWU2 | 214-289 | None |
| E2LXA8 | 52-127 | None |
| A0A7S4J180 | 35-104 | None |
| A0A395J3Y3 | 584-657 | None |
| A0A2G1YXE4 | 1-73 | None |
| A0A5C6S8X0 | 5-83 | None |
| A0A0A2IU22 | 827-902 | None |
| A7F7E3 | 9-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.