DPCstruct | MC39699
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 185 ± 28 aa |
| Standard deviation of domain lengths | 28.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8W661 | 10-216 | LFLRRGVLQFVVIKPALAILIMVLKVFGQYEEGFISWESSYLYLSFAYNISVCWSMYCLVLFYIQCSHDLQPCRPMPKFICVKAIIF… |
| A0A0D2HW01 | 160-316 | WYRKRWVFIFQYVVVSLGIAVATDITQAINKYCLESSNIHFSHLWLTIIHNISITVAVAACIRFYNALKKDLKHHKPLAKFLSFKLI… |
| A0A4Q6GDM8 | 67-253 | None |
| A0A835XRL6 | 176-355 | None |
| A0A094HD99 | 131-331 | None |
| A0A842Z9E8 | 44-210 | None |
| A0A835ALB3 | 147-301 | None |
| A0A4P1RA51 | 41-199 | None |
| A0A1X2G9J9 | 29-220 | None |
| A0A218Z6Y9 | 4-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.