DPCstruct | MC39694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 137 ± 27 aa |
| Standard deviation of domain lengths | 27.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A246FG71 | 3-140 | ALLYQPLGPASVVQLHADLPNDVLDQIPFLRLTEAFLRLLQRETPLRLTPLGALPRKYLRELYASGFILEEGLETGLFTLSREIDSL… |
| A0A5C6YE98 | 6-133 | VKTKEDIYLNIPIIKQVKFLFDLIRDQKELKLTNKGFLPTKIVAELYKKGYIKDYLIEQGISKLYKETDSPSIHLAKILVELSTLVK… |
| A0A1N7N4U8 | 4-142 | None |
| A0A2T4JKZ8 | 1-122 | None |
| H9UL17 | 15-217 | None |
| H9ULB7 | 135-300 | None |
| A0A0K2RIA8 | 51-166 | None |
| A0A7W0YWA8 | 11-130 | None |
| A0A6L3DQR3 | 2-104 | None |
| A0A7W4I980 | 2-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.