DPCstruct | MC39691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 206 ± 19 aa |
| Standard deviation of domain lengths | 19.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8PY57 | 531-730 | LPEDRVREIALNPTGVVRHYLAAHLPLWGGDVVPSLFLHMSTDGRTMHIQAERRILSPVHAWYHEIDLLPATATATRLRILRLAGVG… |
| A0A1A9DPB5 | 1-197 | MPDRLYLRAQTVSWSGQLVVNIFVHAALEAGELRLTVRPHVMTPLYNELRATTAPLARRGIRRLGWVVVQALLDAATGPLALWRAVA… |
| A0A327Z4E0 | 229-393 | None |
| A0A4S2UX35 | 125-358 | None |
| A0A1M7RNL7 | 1-224 | None |
| A0A419HEH5 | 146-323 | None |
| A0A429I3Z4 | 415-617 | None |
| A0A2S6GZN7 | 410-612 | None |
| A0A6P2BPA2 | 293-497 | None |
| A0A269TN14 | 308-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.