DPCstruct | MC3969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 120 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9I174 | 41-154 | ECRYYKQRGSGSGGCFLTTVCCEEKGLPDDCYELTMMRKYRDEILKKTVLGEKIIKFYYNEAPRIVQQIKGSDKREEICTWIYNEIR… |
| R6SQ47 | 64-171 | GEKETTDTSCYLTTACMRHKMEKFDDNCEELMILRWFRDKFVSKEDIEHYYKTAPTIVDVINESENNNEIFNFIYENVVSACVNAIK… |
| A0A7I8CM47 | 161-277 | None |
| A0A1Y3TH78 | 729-853 | None |
| A0A0D0S751 | 151-262 | None |
| A0A838RM83 | 385-523 | None |
| A0A6M0FWW6 | 256-374 | None |
| A0A3D5PAL4 | 187-293 | None |
| A0A2E2B974 | 262-391 | None |
| A0A6G7GPE4 | 495-625 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.