DPCstruct | MC39685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 87 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318CS42 | 1-95 | MKVTRAEILRNLPKKGFRKESLHHIYFYHEYKGMETGAYTYISHSAKQKDVSGDLISSMRKQLRLDSMKETVALIKCPMDKKEYEKI… |
| A0A842ZLT6 | 1-91 | MPLDKQLVRDTLLSKFKFEEVEGTKHGRIAFFYNNKKIATTGFSRGSRKDLDDSLLGIMAKEILVLKLGFFKGMITCSNSRLDYLKV… |
| A0A7W1N632 | 1-76 | None |
| A0A831K7Q0 | 1-90 | None |
| A0A1E3XE87 | 145-235 | None |
| A0A7V4MZM9 | 2-77 | None |
| A0A2M7AEH7 | 1-78 | None |
| X1F9C7 | 5-89 | None |
| A0A6L8GAJ4 | 1-99 | None |
| A0A7X3UC83 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.