DPCstruct | MC39682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 87 ± 16 aa |
| Standard deviation of domain lengths | 15.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.83 |
| Pfam Score | 93.85 |
| Assigned Pfam label(s) | PF01191- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842ZHT9 | 28-108 | LPKSFPVFDIFEHALVPFHEILPEKEKNQLLAQFKLKPYQIPQIKSADPAVKAIGAKPGDILKITRKSTTAGEYVTYRYVV |
| A0A7S1PJN3 | 192-292 | SSQAMNAIDALEAKKYIIEPFKEDELLVNITHHELVPQHVPLSEEDKVNLLQKYKLRDAQLPRMKRNDPVARYFGMKRGQVCKIIRP… |
| A0A7J8IA94 | 70-183 | None |
| A0A2K1J8B7 | 69-158 | None |
| A0A146INC9 | 15-100 | None |
| A0A6C0JTC2 | 111-196 | None |
| A0A662QUY8 | 3-78 | None |
| A0A519DB22 | 16-129 | None |
| A0A445CLW6 | 610-707 | None |
| A0A553IEX9 | 121-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.