DPCstruct | MC3968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 14.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1PGL3 | 1-109 | MSKKITPTNVSHDLVKVLLQLFRDNWQGQAVRCIGVNYSKLSPDCSLQLNILEDPELQLKRYKLDRVVDQVRKKYGFSSIVKASSLM… |
| A0A501P8Z3 | 1-81 | MRQIGVSYSGFVDESYTLLSLFDDVEQIEKDNRLQTAIDVVREQFGFLAIQKGTVLTEGSRNIERSKLIGGHSPGGLEGLK |
| A0A844EES3 | 133-232 | None |
| A0A0Q3VFD3 | 4-80 | None |
| A0A1C5Q7B1 | 111-185 | None |
| A0A1K2HKE1 | 132-230 | None |
| G9R792 | 304-379 | None |
| G6F3V9 | 78-184 | None |
| A0A7X7KSE2 | 356-430 | None |
| A0A242LB51 | 38-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.