DPCstruct | MC39679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A194V6J9 | 1-127 | MSGIEVAGLVLGAFPLILNCLDYYREGFEPLEEWWNFRTHFIAFIDDVRHQMMKYRENMIRLLDPIIADTDSLKAMVEDPTDPRWSD… |
| A0A842ZEE1 | 1-147 | MSGLEVAGVVLGAFPLAIAALDRRRDLARRLNLWQAIRPEYFSCKTDLGFHRATLTSNLRQLLLPLVVDDTTINQLLADPGGEGWKD… |
| A0A1B8ESL8 | 1-131 | None |
| A0A4U0WBV8 | 1-158 | None |
| A0A1U8QGA2 | 2-152 | None |
| A0A0J6Y595 | 1-144 | None |
| A0A101MP25 | 4-136 | None |
| A0A4Q4TBE3 | 1-149 | None |
| A0A6C1MCW0 | 1-142 | None |
| A0A1S8B2K0 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.