DPCstruct | MC39677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 115 ± 14 aa |
| Standard deviation of domain lengths | 14.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.47 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0010- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498P3B6 | 1-82 | MKISSKTVMMVGFEDVKQKQRLETLTEVGLRRCEVSGPGPENEIRNTTPIAQSLDLSGNLLSSWEVLAAVTEQLESLQVLQL |
| A0A842Z826 | 1-118 | MRPSRPSEPPQSFISALHEKYASEVDSGGSRRLIEISGKVVEEVGFDKIRRQLARVGDLKIVILDAMRIGFAVGEGEGGVRETCPRI… |
| H0EJR4 | 56-198 | None |
| A0A444T5P7 | 1-100 | None |
| A0A261Y892 | 245-351 | None |
| A0A7R8CBR1 | 73-186 | None |
| A0A2P6N0V4 | 9-128 | None |
| A0A5N5JZI7 | 87-202 | None |
| A0A7R8X8J2 | 135-245 | None |
| A0A2B4SAF0 | 766-857 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.