DPCstruct | MC3967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 19.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E8GZ61 | 154-309 | NHQHRIWDRIKEYLQHTGTVSSTQDVCAIYDQFGDDVDSLSQIFPLRPGQVGCICAVGQDLFVEIYGEPEVLEDRYEGVLRSALVEA… |
| A0A1F4ZZZ7 | 160-317 | NKVAEMACAMGVPSKTGAMRDVYEAKGADLDGFLKSFRLADGQKGILVFVDGRPAGLDFVSREKAFSELFPKLVKSYAMEAMLLAEE… |
| A0A7V4HQG8 | 184-332 | None |
| A0A1V5FN69 | 350-501 | None |
| A0A1V5IDT5 | 2-104 | None |
| A0A7V2UVJ2 | 467-633 | None |
| A0A1F6ZTX1 | 90-222 | None |
| A0A7V8ZJY1 | 4-108 | None |
| A0A7W1L0C9 | 128-275 | None |
| A0A6N8ZVP9 | 377-532 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.