DPCstruct | MC39668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 94 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0ZMR1 | 163-260 | IDYIKWDMNRNITNLGNGLTYLETQMQSHQYMLGLYELVSYLTEKHSHILFESCSGGGGRNDLGMMRYFPQVWASDNTDAIARLPIQ… |
| A0A2L2MR60 | 73-202 | RQSNSAMAHRSEPARRRRPPLCAWPGRSWAAGTGAGGRVDLDGARVANLHRIYEQLRRDHPHVLIDACAGGGARTDLAMAARADIFW… |
| A0A2N3B297 | 98-180 | None |
| A0A2H4S5T0 | 1-109 | None |
| A0A556RKZ5 | 16-78 | None |
| A0A5J4YPU6 | 721-817 | None |
| A0A3D8SZF0 | 199-295 | None |
| A0A395VT45 | 454-559 | None |
| A0A0G4LLM6 | 823-916 | None |
| C5L5W7 | 57-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.