DPCstruct | MC39666
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 132 ± 23 aa |
| Standard deviation of domain lengths | 22.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6IL38 | 20-156 | RTGEKVLLPALQKLGEGYGQVAKPLPAQFFLSLDELEAISTAIAGYNEVIAEAAAEHNLALVDMHGMMERLKTGMVVDGNNYSSTFI… |
| A0A7Y2JK13 | 242-408 | IFDESLTDLTQINPALVSMRQATAADLVVLTAASFIGTEAIPGNAQTVNGVAIPLADKWVLTPEEQEEIATATTSYNASISAVASAN… |
| A0A2V7Y5U0 | 377-519 | None |
| A0A1I4V9P3 | 31-156 | None |
| A0A2D4ZVU3 | 312-480 | None |
| A0A1H9CH85 | 107-233 | None |
| A0A2V7H7J7 | 62-167 | None |
| A0A7Y5G8G1 | 9-126 | None |
| A0A4Q3RNU6 | 1-95 | None |
| A0A2E4FER3 | 348-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.