DPCstruct | MC39665
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 215 ± 19 aa |
| Standard deviation of domain lengths | 19.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6BWE0 | 20-206 | GAANVQAVDYDLSICGVQVTDANKDNLTAAINNAGNGSTITGTVKFNSDNNTVRLENANIYTPGVAIAGSNNKVELVGNNTITSLHD… |
| D7JFY6 | 16-227 | ILNTFETQAAPLTYYELYIGGTQVSSGGLSSIRGRGIKGKISYNPKTKTLTLNNANISMVRGINGISNTGIDDLIINLIGENEINAL… |
| A0A349VRX1 | 33-216 | None |
| A0A7X8KER6 | 315-553 | None |
| A0A0A2EWS5 | 15-220 | None |
| A0A6P1TSZ6 | 143-375 | None |
| G5G9Q5 | 18-258 | None |
| A0A1H7KTZ1 | 26-246 | None |
| A0A7W4EVX1 | 10-219 | None |
| A0A2N6QND0 | 269-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.