DPCstruct | MC39663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 183 ± 52 aa |
| Standard deviation of domain lengths | 52.27 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0063- PF00067- CL0475- PF01784 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853QYK0 | 6-195 | LELYLNNTLETARFKDYCPNGLQVEGRRKIEKIATGVTASVAFLEAALEWGADAVLVHHGYFWRNEAPQITGRKYQRLKLLLANDLN… |
| A0A7C6BD10 | 26-204 | GKILTKAIKNDIVLYAAHTNIDNAINGVNGILAEKIGLVNLRPLNKGSYLDNENFLGSGAIGELEKPMEKVAFFQHLKETLGLSQIT… |
| A0A0R2FPC1 | 8-333 | None |
| A0A6A5SX80 | 56-292 | None |
| D6E4R1 | 16-182 | None |
| A0A2E8P6C2 | 339-583 | None |
| A0A521GHL1 | 359-483 | None |
| A0A182JW27 | 553-757 | None |
| A0A645J667 | 2-112 | None |
| A0A356U768 | 329-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.