DPCstruct | MC39662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 125 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12473 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822BI25 | 1-120 | DLIEKRKLYLESEVKMLSEQTNKTSNDLERETTLLEQLVRLAEERNFAEFPPPGSGIPGSPPCWTPPQTIEEHRPLIFLNLDPVNMN… |
| G1MUW7 | 115-231 | NKQEKSEDDIEREARLVEQWVGLTEERNAVFVPAPGSGIPGAPANWIPPAGMETHIPVLFLDLNADDLRVNSILPKEHGSPFFYLPI… |
| A0A232FM95 | 1-140 | None |
| A0A0M3IPH9 | 265-394 | None |
| A0A1S3SBF3 | 136-241 | None |
| A0A0R3WTJ7 | 90-215 | None |
| A0A6A0GT86 | 107-235 | None |
| A0A7R9HY76 | 54-182 | None |
| A0A834BTQ8 | 69-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.