DPCstruct | MC39660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 499 ± 72 aa |
| Standard deviation of domain lengths | 72.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 40.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7NXC8 | 1-403 | MDVPPSWLVAPKESIHDLDNLKLSSLKDGTNVDAIYELEHILIEGHSRDVTLSAPPKGVQLLLGTEKNPHFADTIIMANLGYFQFKA… |
| A0A482WZN0 | 13-482 | VSSTSQPPSPAHSSADPKWQAPAFDITVIVDPVSRGAQKIGPILSVLRQVVNCDIRIFLNCVEKNSDMPLKSFYRYVLEPEVQFTAD… |
| D7G654 | 452-1036 | None |
| A4I4S1 | 1149-1752 | None |
| E7F6G9 | 961-1509 | None |
| A0A0G4N9E1 | 280-832 | None |
| A0A0R3Q4Z4 | 151-634 | None |
| A0A3Q0KM82 | 854-1421 | None |
| A0A7J5Y7N8 | 1-451 | None |
| A0A7T8H1B1 | 523-1021 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.