DPCstruct | MC3966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 112 ± 17 aa |
| Standard deviation of domain lengths | 17.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2XFY4 | 2-86 | TSLYRSSIPEGMPVSETFELASVNTLLSQSGCTALRIYYGKKEDGTIHAILVGVNEKGEDITKGVILEEAQRCPPECPPDSLLNK |
| A0A7Y4YF30 | 6-126 | VPGAQDTIPEQLAVTITTNWRDYISKHDPDPNYIRAFNIPMVDIKELAEFYACPSVRAYLAMETPGDITTLKIVLVPVDANGNDILS… |
| A0A1M3IHA3 | 41-160 | None |
| A0A7W6P6S3 | 9-144 | None |
| A0A838YL29 | 6-146 | None |
| A0A5N5ZAL6 | 5-120 | None |
| A0A2E2SM15 | 4-123 | None |
| A0A4Q1CNU3 | 12-111 | None |
| A0A317ENQ4 | 1-120 | None |
| A0A4V3E781 | 26-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.