DPCstruct | MC39653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482WL34 | 19-123 | AERRQRAFHKNDDMHISVKELWEAWLRSEVHNWTVEQTTEWLTSSVELPQYVPVFIVNRVTGASLPRLAASNMQFMTNVLGIKDPIH… |
| A0A0M3J3G5 | 68-171 | EKREKAFHHNNDEQITVDDLWEAWFASEERTWTTAQLMNWLENSVKLPQYSNNLIARNIDGRALPRMAVANSSFLSHELGIKNAVHK… |
| A0A653BNE3 | 1-104 | None |
| A0A803KHX8 | 1-164 | None |
| A0A5K3EW12 | 118-224 | None |
| A0A0R3RL15 | 86-209 | None |
| A0A813QBA4 | 4-118 | None |
| F6TB84 | 84-199 | None |
| A0A0N5ADQ6 | 30-154 | None |
| A0A3P6TYT5 | 56-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.