DPCstruct | MC39642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7ZX13 | 1-116 | MSDTTDRKLEGPLRDICDGACGIYWTYADNFYLCKECDYIKFDQRCLDNLRNGTMKLKICNKDHEMLHIPAYDPVERRRVGDGNVKV… |
| A0A3L6NFM5 | 88-181 | FWCDGCRADITFASEIWTCLSESGSIQLDDKCYKKLKEGIQGPVCSKEHEHYWVPKRNMEEIDAVPVGSVELGDEVISFEAWKEKIR… |
| A0A384JSY6 | 136-273 | None |
| A0A420QIV8 | 5-95 | None |
| A0A4Z1FCP2 | 65-197 | None |
| A0A2P4ZQZ9 | 811-916 | None |
| A0A2V5I0M0 | 139-256 | None |
| W7EDT6 | 6-125 | None |
| A0A0I9Y4R2 | 661-762 | None |
| A0A1Y2UNP3 | 224-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.