DPCstruct | MC39641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 343 ± 49 aa |
| Standard deviation of domain lengths | 48.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5G386 | 45-372 | IKHAEELVNSNSITDLVENTENLYYALYARLIMEIAAVHLCASFTLGFRRPESDRSFQLPEPREICKTFLLCKQMLDEEDVCNHLNK… |
| A0A7R7WSC7 | 4-329 | IRDAEDAIASKKIAPLVECVEKLYHALYARLMMELVMVDLCSCFSIEVTRVSSHNNFMLPEPRHLYNIFLTCKQILDSPTVCKIFNK… |
| A0A2B7WZN3 | 41-399 | None |
| A0A232LNM6 | 17-341 | None |
| A0A1S9S1I6 | 194-513 | None |
| C1H4I2 | 9-492 | None |
| A0A229XRL5 | 477-835 | None |
| A0A1V6PGE4 | 269-592 | None |
| A0A093UYH9 | 141-443 | None |
| A0A0K8LNK7 | 776-1127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.