DPCstruct | MC3964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 529 ± 107 aa |
| Standard deviation of domain lengths | 106.68 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1ZV48 | 2-425 | QALTDRMSSKAKQYFIREINALHTVDNENIRFKRLEGLTPQELYYLIVLGEDEIYTSSYLNVYKKIFQRMAVPRGDSLLLTVNGDYF… |
| A0A7Y4YBT1 | 14-519 | KLIHNSTNPAVKTVAALSKIPSPLLYFPFLDDIISGRKQTDSLKKIIGDGDKGYDSLAYYKLLVQTEIGYSKRMTKGDTAIAFFGPN… |
| A0A3D6CEL9 | 135-729 | None |
| A0A5E4LQV8 | 5-537 | None |
| A0A521G561 | 134-806 | None |
| A0A7Y2XB06 | 4-363 | None |
| A0A3C1LJ47 | 13-293 | None |
| A0A3C0R9V7 | 66-604 | None |
| A0A849TMA5 | 75-683 | None |
| A0A2A5GX00 | 21-644 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.