DPCstruct | MC39636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Standard deviation of domain lengths | 12.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A119A3B8 | 264-382 | REQAQAVALQEQRQQTQLRQESQARGQWLLWTGLLLAAILGGFVWHRFIRHRCPSCKSLNFDCTGHKEMDRFKGRIKVHEKNSRGTN… |
| A0A413SV64 | 6-133 | SLKWILLAAPILNILIVLSGEESVSKWLPSELTFIVVAIGILYFCYGRKSTCPECRKIFALKKTKEEIVGQEDVSVLVETKMRNNRQ… |
| A0A2M6ZTP1 | 146-262 | None |
| A0A379MVC8 | 195-308 | None |
| A0A415S240 | 526-639 | None |
| A0A0Q8BXM4 | 108-242 | None |
| A0A417AWM3 | 346-478 | None |
| A0A2U8FJ22 | 51-173 | None |
| A0A372UHK5 | 182-304 | None |
| A0A2E0R145 | 190-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.