DPCstruct | MC39635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 75 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08881 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370L0R4 | 3-84 | ALLAASLALAALGASLPAEAQVRGSYRATCTDVRQRGPILEAVCQNRFGQFTPTRLDIRSCGYGDVGNQNGRLVCAGGRGER |
| A0A7S2FUH7 | 122-183 | GTRSLPPGGYLNSCAGCVVEKGMMLRCTHCEAADGRQVESVVSLDECEGKGRIDNRNGDLVC |
| A0A3B0Y617 | 231-296 | None |
| A0A7S0DLJ1 | 87-166 | None |
| A0A813FJU4 | 797-875 | None |
| A0A4S1M8P5 | 25-101 | None |
| A0A7T9ELK1 | 115-182 | None |
| A0A2L0F9R5 | 57-135 | None |
| A0A1X7AQ98 | 1-80 | None |
| A0A1E4GS90 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.