DPCstruct | MC39632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 198 ± 24 aa |
| Standard deviation of domain lengths | 23.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3JYC3 | 17-236 | DAANQFLQELLINNNLAQGYLNIAQQANGQDNAPTRLTDWLQGQGYDTTPALIYGALVAVQNTTLGYWLGIYGQSYQQNPPIAAPVL… |
| A0A7D9JMM1 | 195-356 | SNNAARAAAIELLTSNSFCKSYADEMKKYVHDPDLDTKLTAFLELHGFKTTPDAVQNALQELRESSLLPWRQVYHTSVGILEIRCKN… |
| A0A5E6N5L1 | 32-232 | None |
| A0A066YLN8 | 387-566 | None |
| A0A1Z4Q6Q3 | 109-322 | None |
| A0A0P7AQ33 | 1-213 | None |
| L2FRD4 | 7-242 | None |
| A0A7D9LYK7 | 291-452 | None |
| A0A2V4ZS81 | 69-290 | None |
| T0KES9 | 2-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.