DPCstruct | MC39629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 15.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2GGR0 | 4-111 | LYSEALLLALIIGPPAPATAEVNVHIGVPAPPAVVLPALPALVVIPETYIYAAPDIEEDVFFYRGWWWRSRNGHWYRSKQYNSDWTP… |
| A0A363TSF9 | 2-123 | AEVDVSIGISLPPAIVFQAPPEVIVLPDTSNVYIVPDVDIDLFFWNGWWWRPWEGRWYRSRYYNRGWVYYRSVPSFYYDVDPGWRRS… |
| A0A258TWJ3 | 10-128 | None |
| A0A3D0I7X0 | 61-184 | None |
| A0A1V6CD78 | 53-212 | None |
| B3EQ51 | 3-132 | None |
| A0A3A5AA66 | 1-110 | None |
| A0A419FZ54 | 2-131 | None |
| B4UE82 | 1-118 | None |
| A0A522UIA3 | 19-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.