DPCstruct | MC39628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 127 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2G9A2 | 1-124 | MNHIMHSYAYLHAFLNILSCKNIMTELETPNKKIQQKRATKGKLPLVSFYTLKIINVGHGKDSTDSKKDLWSNRIHFCRGHMREYSV… |
| A0A256WFF9 | 155-276 | SNEDGSVLDVSIAIIQRFLQFLSCANICTVKCIQNEKLSKKRIKHGKLPFVSYYILKLKRKTKNKKGVERHLWTNRVHLCRGHFKTY… |
| A0A3D5W5M5 | 307-426 | None |
| A0A7W7HL39 | 288-404 | None |
| A0A1C6R7I2 | 384-504 | None |
| A0A7D5VNI9 | 218-333 | None |
| A0A2E2UYN4 | 178-315 | None |
| A0A329LWS6 | 2-128 | None |
| A0A841BNZ6 | 12-149 | None |
| A0A5M9ZVT2 | 114-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.