DPCstruct | MC39623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3JFJ9 | 8-117 | LALPGAHSDIGGGYNPAEHEAYFLTRPQFETVPLPTPDTETQIYQQTCEQLKAMDGYPAIAPLLHSVEVSIDTWHDNKMPADRYGTL… |
| A0A1S2CEQ2 | 45-148 | LPGAHSDIGGGFPENFHERIQVGQPRKFRGYHPRDSYEYTGILMERKRIASEGWLGPHNLDGTLNIEEAYRRQLKEGEVELQFRLWL… |
| A0A4U9V695 | 34-143 | None |
| A0A509CGH6 | 1-110 | None |
| A0A2P6JJR5 | 3-135 | None |
| A0A4R8KKB4 | 297-404 | None |
| A0A6D2G366 | 110-206 | None |
| W6VJU0 | 935-1038 | None |
| A0A447MPX4 | 440-546 | None |
| A0A4R6IFD0 | 603-707 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.