DPCstruct | MC39622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 20.51 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3JEK6 | 19-192 | IALIKSLPKPVRRNFVPAPNYAEAFLGRATPLELPLLDSLEREFRRMAGISIDREDWHWDQVPDHLKMTFRVVDEHNKKLKEGKDLS… |
| D0WBX5 | 38-226 | GVTMTVPLTVLNRLHAPSLEWLVPGMLREKIQLLIKALPKQIRRICVPVPDFITKFLESNPDRQAAIIPQLAHFIAKSAGDMRILEQ… |
| A0A447PJD3 | 1-146 | None |
| A0A1Q9VYK2 | 15-224 | None |
| A0A1S2WVC4 | 479-660 | None |
| A0A7Y6SL20 | 1-152 | None |
| A0A0D9L7Z0 | 126-314 | None |
| A0A7X9CCY8 | 5-164 | None |
| A0A257VXG7 | 13-159 | None |
| E2PIK4 | 711-894 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.