DPCstruct | MC3962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 357 ± 89 aa |
| Standard deviation of domain lengths | 88.96 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0LXL7 | 322-751 | LSATIKKANDLKIWFENISNKPCNLIEHSIRFLNLQRHVWNKNILEKIHPLACLDVEDITEEFLNNNLPLTPFDSIQLFKSLKNNLP… |
| A0A815EX71 | 4-394 | LSATVNNGHEIQKWLKHIEHRRYELKQASSVRRVRLIISHKRFTDLHKYLYFNQQLQSIHPIGLMDSEQLMKNGSLPNDFILSPKET… |
| A0A842YVJ4 | 15-300 | None |
| U6KVU0 | 127-599 | None |
| A0A7S4A060 | 388-810 | None |
| A0A0D2HN43 | 51-440 | None |
| A0A6C0JLS9 | 313-772 | None |
| A0A820Z9K0 | 334-721 | None |
| A0A813KH36 | 1-448 | None |
| A0A420QVB8 | 98-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.