DPCstruct | MC39616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 88 ± 13 aa |
| Standard deviation of domain lengths | 12.56 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2J384 | 1-100 | MKLAFIIDPIAKLDPGHDSTVAMMEAAQILGHEVWITEVHQLSVIDGKALAILSQVQLVPVTLKEGKWLSVPQWYELSSPELRCLED… |
| A0A2X2TFT7 | 1-85 | MIKLGIVMDPIAHINIKKDSSFAMLLEAQRRGYELHYMEMADLYLNNGEARARTRLLSVEQNYDKWYEFGSEQDIALADLNVVTD |
| A0A0F7FQD0 | 1-102 | None |
| A0A7U6G0U3 | 3-86 | None |
| V4JF38 | 1-95 | None |
| A0A1V0M7H2 | 1-85 | None |
| A0A7Z1R573 | 77-181 | None |
| A0A376ZM79 | 51-113 | None |
| A0A523H8W6 | 1-73 | None |
| A0A7J6Z552 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.