DPCstruct | MC39615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 35.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2TDB9 | 1-68 | MIRKAFVMQVNPDAHEEYQLRHSPIWPELEEVLKQHGAHHYAIHLDEQRHLLFATVEIRVRSALECGC |
| W0QFH4 | 1-57 | MQVNPDAHAEYKKRHDEIFPELVTELKNHGSHHYSIFLDKERNLLFGYVEIEDEARW |
| K8BM70 | 307-378 | None |
| A0A1S3IVZ9 | 42-112 | None |
| A0A1S3IVL7 | 122-188 | None |
| A0A3M7D7I7 | 106-168 | None |
| A0A0D9NPP7 | 369-435 | None |
| A0A177YHF0 | 10-75 | None |
| A0A2R5G0L6 | 65-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.