DPCstruct | MC3961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 99 ± 7 aa |
| Standard deviation of domain lengths | 7.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 63.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815R3X1 | 57-159 | HQINRRQYGAYTFDALMLMNKYNYSDEFSLSEQDANELASRLQVGKSIITFNAQRLRSICHTLLAFHELFRRYVLCKSDVALKEPTP… |
| A0A815DQK5 | 1-86 | MNKYNYSDGFSLSEQDANELASRLQVGKSIITFNAQRLRSICHTLLAFHESFRRYVLCKSDVALKEPTPNSKQMAMALEFYLQIDD |
| A0A816TZW9 | 67-169 | None |
| A0A820HI89 | 1-85 | None |
| A0A819ZJY8 | 69-172 | None |
| A0A821YBT7 | 32-134 | None |
| A0A821M7Y1 | 62-164 | None |
| A0A820SJ57 | 130-236 | None |
| A0A815B8J5 | 69-171 | None |
| A0A815WWP8 | 77-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.