DPCstruct | MC39609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 304 ± 40 aa |
| Standard deviation of domain lengths | 40.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8HGQ6 | 343-642 | RPIGHRPRKPQGTKADDARLRDNPWAVALASPPRYCSATAGRIPKAFLTEMNLVRRIDEATDGKVRQTSMWWMPAALLKDKVPSNTT… |
| A0A137QGJ0 | 81-392 | FVPQNARHREGEYDKPRQMTEEERKWWSSPYLLIHELQALLLRLAPVRVDESEPATSYKPLPCIITPDGLEHPKFTSRRSIKSVHVI… |
| A0A397TCM0 | 18-267 | None |
| A0A165IKG7 | 90-458 | None |
| H1VGE7 | 2-245 | None |
| E3Q4K4 | 8-328 | None |
| A0A0S6X5K3 | 9-346 | None |
| A0A6G1HW65 | 1-244 | None |
| W6YQX0 | 40-367 | None |
| A0A395P0F1 | 83-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.