DPCstruct | MC396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 184 ± 22 aa |
| Standard deviation of domain lengths | 21.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6HV41 | 23-191 | LENEVRFHRMHAPCDPLSPFHDLKCGHRVKTQYPEDCGSNCKRPVKDITPIICPDCVTNQVRLDMELEGLTLTKDGDASMEDGDMAR… |
| A0A1X7RLG8 | 1-172 | MNMHITDPCIPGCLIHQLSPCGHKILTPKPEPCASNCKQRSPNTPSGTPTQDAFVCAACVELHVQVHREVKRDVYQHNLEQTEVQMG… |
| A0A6A5ZN86 | 7-176 | None |
| A0A6A6Z7E7 | 21-184 | None |
| A0A6A6A0P8 | 1-201 | None |
| A0A139HB92 | 116-310 | None |
| M2Z6G1 | 327-510 | None |
| A0A7C8MB25 | 1-235 | None |
| A0A6A6F6F7 | 25-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.