DPCstruct | MC39596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 172 ± 13 aa |
| Standard deviation of domain lengths | 13.14 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J8QKJ3 | 1-174 | MQAQGSIRKQTSTIGTGYISAVFRIYDIPSISFSKLISTPFNIANNQFTVITLAIDTSTKAMIGSAGSFKSCHPALICSPLGGGSML… |
| A0A2R6NG72 | 224-399 | QIAIQVQLYPIPAIDFDTLLDGVRFAVDLNDVTNRFLVELFVDASTPNRIGNAGSFKTTHPAHIKLSHNHSEDDTGTILNVPAIVAK… |
| A0A0D0CBV9 | 8-183 | None |
| M5FNL1 | 317-488 | None |
| A0A0C3AEQ6 | 263-428 | None |
| A0A0C2ZRT5 | 1-155 | None |
| A0A165K3T4 | 349-525 | None |
| A0A0C3IJ04 | 380-521 | None |
| A0A0C3P742 | 1-194 | None |
| A0A0W0GAA2 | 100-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.