DPCstruct | MC39594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 257 |
|---|---|
| Mean domain length (aa) | 202 ± 36 aa |
| Standard deviation of domain lengths | 35.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.29 |
| Pfam Score | 40.00 |
| Assigned Pfam label(s) | CL0016- PF20713 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J8Q6J1 | 10-198 | QSHDTLGQISAYVAAHLGAQFHCHIYSLLVVWDEARILRWDRSGTIVSEAISYNNQPHLVEFFARFSAASPQMRGHDTSVSQPTDVQ… |
| A0A067N2E8 | 485-688 | SVIEEKGKLDKNKGPRQSGAYLAFATQCRPDLVGMYGMSISPVGYVLQYSCASGLQTSGEFPWADIGPLVSYVYTLYVPHPGFASRD… |
| F2RWB2 | 2-134 | None |
| A0A284R3B3 | 174-332 | None |
| A0A284QYT5 | 160-343 | None |
| A0A0C9T7N6 | 242-381 | None |
| M1WCC5 | 282-501 | None |
| A0A4S8MCM7 | 106-260 | None |
| A0A2H3C446 | 107-341 | None |
| A0A2H3A0Z9 | 349-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.