DPCstruct | MC39593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 94 ± 18 aa |
| Standard deviation of domain lengths | 18.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 68.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12134 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9DUZ5 | 61-166 | LPFQACLKVEKFGDLILKATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNTERTKVILKPDKTTITEPHHIWPTLTDEEWI… |
| A0A426YIU7 | 1-66 | MVLFNIYDDWLKSVSSYTAFSRLILILRALHVNNDKAKMLLRPDKTVVTQPHHIWPSLTDDEWMKA |
| A0A453Q1T0 | 69-128 | None |
| A0A3P7BAQ8 | 492-593 | None |
| G3IPB5 | 22-128 | None |
| A0A1J8Q4P6 | 53-155 | None |
| A0A3Q0JBQ9 | 374-465 | None |
| A0A1R3IFY8 | 1-83 | None |
| A0A7S0YUK7 | 781-886 | None |
| A0A2P6RSU2 | 106-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.