DPCstruct | MC3959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 147 ± 31 aa |
| Standard deviation of domain lengths | 30.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815D0H1 | 31-150 | MKNFKQILLIPLPFWVGTSETFLFGVFTNSFITCSMGVEYVGLIMFGFGITACIFSLIVGYVVKFEHRLQWFLLAFLAYYVLLITML… |
| A0A6J1SFR2 | 743-874 | CGLQERPPSHLRSVWDSFKDARMQLIIPLSIFIGLEQGFMLADFSKWYVVCSLGLHNVCLVFMSMGLMQSVAAFTLSMLLQHIRRYI… |
| S4RJK9 | 12-209 | None |
| A0A6H5IM15 | 563-747 | None |
| A0A816FUD6 | 4-141 | None |
| A0A815SVH7 | 290-425 | None |
| A0A3P7GHZ1 | 2-113 | None |
| A0A4Y2A9J5 | 331-459 | None |
| A0A819RCV2 | 1-120 | None |
| A0A5D2VDS6 | 3-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.