DPCstruct | MC39584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 136 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z1WPZ1 | 2-134 | FREVQDAQVDDRYFTPALRAADKVGLRSPLAVAELYDASIQHGNGSDGDGLPALVRRTTAQAGTPAEAGEKAWLDAFFDVRVHDLTH… |
| A0A7Y8ZXH4 | 20-163 | GKNDDIKGLDNFIKDVKACNDPLFKKAQLYELDEMYWKPAVSLATSIGAKHQLTLAFIYDMCVNHGEDGAKEYINSAKKKLGGLPKD… |
| A0A101GL71 | 5-147 | None |
| A0A1H7KE33 | 125-252 | None |
| A0A7C3RZI3 | 86-221 | None |
| A0A6N7A6R0 | 93-244 | None |
| A0A022MKR6 | 521-647 | None |
| A0A7R9KSE9 | 1-128 | None |
| A0A0B7NUS3 | 714-842 | None |
| A0A2R6XK99 | 213-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.