DPCstruct | MC3958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 282 ± 27 aa |
| Standard deviation of domain lengths | 26.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 61.26 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0020- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821CCM2 | 150-422 | GPCPQNQLALANSRLWDAIAGFLYIFAHMQRKLSQDPTQIELLREFMKLQKDMIIMLLSMLEGNVLNGPIGKQMVDTLIESQVNVEL… |
| A0A815BFD1 | 1-269 | GPCSQNQLALANSRLWDAIAGFFYIFAHMQRELSQDPTQIELLHEFMKLQKDMIIMLLSMLEGNVLNGSNLITSEAFQEYDINKDGF… |
| A0A1S3T2W2 | 98-410 | None |
| A0A834DAY0 | 1-281 | None |
| A0A820XHQ8 | 281-554 | None |
| A0A821JZC0 | 1-277 | None |
| A0A2R7WGW6 | 308-587 | None |
| A0A6I9NYN9 | 60-369 | None |
| A0A556V2Y2 | 206-520 | None |
| A0A821YS01 | 65-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.