DPCstruct | MC39574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 127 ± 25 aa |
| Standard deviation of domain lengths | 25.17 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9UFR0 | 27-156 | PVYEQGRTVRFTAEQNGLDRGGSTWGPTRLVYLQHASDPIVFFSPSMAFSSPEWLKDGERGPDVSARMGWFPLVTMWQVLLDLPGAG… |
| A0A833CJ05 | 30-130 | RFVYLQYASDAITFFDKSLAYREADWMRSPRGPDVSPMLGWYPIVSMLQILIDMPLADTVPMGYGHVYAPDHYLNAWLEVTGVEGWS… |
| A0A7K0XHS5 | 109-267 | None |
| A0A7C9R9S9 | 92-220 | None |
| A0A6G3VRJ9 | 130-255 | None |
| A0A0D0NBU1 | 123-216 | None |
| A0A066YLS5 | 2-90 | None |
| A0A7K0P4K4 | 50-191 | None |
| A0A1I4SD10 | 45-177 | None |
| A0A1G9JRP3 | 277-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.