DPCstruct | MC39573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 313 ± 49 aa |
| Standard deviation of domain lengths | 48.86 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.63 |
| Pfam Score | 79.05 |
| Assigned Pfam label(s) | CL0193- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7A6X5 | 150-427 | VLNARLLESSRLAGSIAGAHLAVDGTSQWTMTANSTLSGLDLAGHIATPDPGQVFTARTLTVAGNWAGQGGTVQLHTALGSSDSQTD… |
| A0A7X6FTC9 | 29-293 | GSNGTLVINTVLGDDNSRTDRLKVGGDTSGTTNLQVVNRGGIGGQTVNGIEVVDVAGQSNGTFSLVSDYTTKDNKKAIWAGAYAYTL… |
| A0A485JG00 | 239-488 | None |
| A0A3M0CKG1 | 523-848 | None |
| A0A8A9YC01 | 775-1089 | None |
| A0A2L2M0U1 | 14-316 | None |
| E6YUT5 | 131-438 | None |
| C5EZJ3 | 458-765 | None |
| A0A7U8PE06 | 152-386 | None |
| A0A853FWI6 | 285-661 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.