DPCstruct | MC39572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 197 ± 19 aa |
| Standard deviation of domain lengths | 19.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8WD27 | 6-178 | GRNPAAEIEYWAKLAFWSIEEGVTLSYGYDPRVVTWVFLRDSGHPSAWRYANRLSQALRARDMGHLGDRNVPTDFIRWAKSLSLSFA… |
| A0A841FWF3 | 4-207 | ESAITLPAGMTPANYAHWARAKSWTKSECVALALGAEPIDEPYYDPLHEYRTDTRSADERRFAERMDRMATLVVRHFGGQLDGATIS… |
| A0A258TWW1 | 1-195 | None |
| K9RZB0 | 1-170 | None |
| A0A259PAM9 | 50-245 | None |
| A0A2E4S6W4 | 1-224 | None |
| A0A431JT94 | 85-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.