DPCstruct | MC3957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 65 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 61.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815BAQ3 | 1-64 | MDAIQQFLGQQNIIVPEEFVIGGASKRGWMTWTTAAVDNKRVIGAVPIVMDLLNFRPNMMSHYR |
| A0A820NF18 | 1-61 | MDTIEQFLKQQNLIVPEEFVIGGASKRGWTTWTTAAVDNTRVVAAVPIVMDLLNIRPSMMS |
| A0A814SL86 | 48-100 | None |
| A0A815GDN4 | 69-125 | None |
| A0A819D7Z2 | 1-70 | None |
| A0A819V3I6 | 69-128 | None |
| A0A5A8C525 | 1-76 | None |
| A0A821W6V1 | 82-152 | None |
| A0A821PMS3 | 1-64 | None |
| A0A3M7R2W3 | 31-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.