DPCstruct | MC39554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.13 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0023- PF08463 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084XVJ8 | 1-99 | MLDTGIDIPEVVNLVFFKLVRSKTKFWQMLGRGTRPCLDLFGPDQQKTFFYVFDYCQSLEYFSQDIAASEGALGEALGKQLFNARLE… |
| A0A1Z4VRB5 | 680-791 | DMLDTGIDVPEVVNLVFAKPVRSLVKFWQMIGRGTRLCENLFGPGEHKSEFLIFDHYSNFTYFDEEYQEADEQQGKSLLQHLFETRL… |
| A0A2T5UU33 | 1-115 | None |
| A0A7Y5KFY4 | 359-486 | None |
| A0A3S3U867 | 30-138 | None |
| F4XC25 | 8-82 | None |
| A0A0M4GQZ7 | 72-185 | None |
| A0A5J4F434 | 2-124 | None |
| A0A3S4XU24 | 2-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.