DPCstruct | MC39551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5DFC5 | 1-83 | MLYASAAVESFRTHGIPARYVEGYYLSDNQIAQSDDGHELLSGEDMHAWAEVYFDGVGWLPVDVTPGYYYDTAELRTVIWKNL |
| A0A1Y4M2S5 | 1-104 | MFRMYGIPARYAAGYAVSPSDFTENEDGWHAEVTDEAAHAWPEIFVENVGWIPVEATPSARGEMTVYPGMDEEVLRAELNVQTVVYI… |
| A0A6N2WER8 | 49-130 | None |
| A0A413M8F3 | 261-353 | None |
| A0A2G6JSJ9 | 28-110 | None |
| A0A7C2HKS2 | 55-163 | None |
| A0A2R6M7A6 | 2-125 | None |
| A0A1Y4NZD6 | 127-243 | None |
| A0A374EUG5 | 15-121 | None |
| A0A417GQM6 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.